PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009119842.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 232aa    MW: 27294 Da    PI: 7.4962
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009119842.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.11.1e-25120170252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +++++l++++kyF+ pi +AAkeL+v+lTvLK++CR++ I RWPhRk+ksl
  XP_009119842.1 120 QDKLELSEIRKYFDRPIMKAAKELNVGLTVLKKRCRELEIYRWPHRKLKSL 170
                     6799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2107192IPR003035RWP-RK domain
PfamPF020421.3E-21123170IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MDPNSLQPLD SMKIENQYEP DSLFDMLERL PPLESLLDTE YLRPDPGLHF EYQYNSFEDF  60
FENIEVNNTI SSDILMLTQE PYFSSDSSSP LVVQNNHCPS TNERREKKAP KKRNTRAKRQ  120
DKLELSEIRK YFDRPIMKAA KELNVGLTVL KKRCRELEIY RWPHRKLKSL NSLISNLKGV  180
GMDEEVKNLE EHRVLIEQEP DAELTDGTKK LRQACFKAKY KRKKSLANDG YY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119842.11e-172PREDICTED: protein RKD4
RefseqXP_013726811.11e-172PREDICTED: protein RKD4
SwissprotQ9LVU81e-115RKD4_ARATH; Protein RKD4
TrEMBLA0A078IEW61e-172A0A078IEW6_BRANA; BnaA10g06400D protein
TrEMBLM4CFV61e-172M4CFV6_BRARP; Uncharacterized protein
STRINGBra003088.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125852230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-106RWP-RK domain-containing protein